Product Description
Size: 20ul / 100ul
The GNA12 (83263-4-RR) by Proteintech is a Recombinant antibody targeting GNA12 in WB, ELISA applications with reactivity to human, mouse, rat samples
83263-4-RR targets GNA12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: MCF-7 cells, HepG2 cells, HeLa cells, mouse pancreas tissue, rat pancreas tissue, HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:14000
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag35068 Product name: Recombinant human GNA12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-172 aa of BC087537 Sequence: DKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSE Predict reactive species
Full Name: guanine nucleotide binding protein (G protein) alpha 12
Observed Molecular Weight: 41 kDa
GenBank Accession Number: BC087537
Gene Symbol: GNA12
Gene ID (NCBI): 2768
RRID: AB_3670934
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q03113
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924