Proteintech, 83266-5-RR, BUB3 Recombinant monoclonal antibody

Size: 20ul / 100ul The BUB3 (83266-5-RR) by Proteintech is a Recombinant antibody targeting BUB3 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples 83266-5-RR targets BUB3 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, MCF-7 cells, Jurkat cells, C6 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25608 Product name: Recombinant human BUB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 205-328 aa of BC005138 Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT Predict reactive species Full Name: budding uninhibited by benzimidazoles 3 homolog (yeast) Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC005138 Gene Symbol: BUB3 Gene ID (NCBI): 9184 RRID: AB_3670939 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O43684 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.