Product Description
Size: 20ul / 100ul
The EPHB2 (83277-1-RR) by Proteintech is a Recombinant antibody targeting EPHB2 in WB, ELISA applications with reactivity to human samples
83277-1-RR targets EPHB2 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HepG2 cells, U-251 cells
Positive FC (Intra) detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag28786 Product name: Recombinant human EPHB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 886-986 aa of BC018763 Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG Predict reactive species
Full Name: EPH receptor B2
Calculated Molecular Weight: 987 aa, 108 kDa
Observed Molecular Weight: 120 kDa
GenBank Accession Number: BC018763
Gene Symbol: EPHB2
Gene ID (NCBI): 2048
RRID: AB_3670947
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: P29323
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924