Proteintech, 83288-2-RR, NUP85 Recombinant monoclonal antibody

Size: 20ul / 100ul The NUP85 (83288-2-RR) by Proteintech is a Recombinant antibody targeting NUP85 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 83288-2-RR targets NUP85 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, mouse liver tissue, HeLa cells, K-562 cells, HepG2 cells, COLO 320 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Nucleoporin 85 (Nup85) (also known as FROUNT) is a protein that in humans is encoded by the NUP85 gene. This gene encodes a protein component of the Nup107-160 subunit of the nuclear pore complex. Nuclear pore complexes are embedded in the nuclear envelope and promote bidirectional transport of macromolecules between the cytoplasm and nucleus. The encoded protein can also bind to the C-terminus of chemokine (C-C motif) receptor 2 (CCR2) and promote chemotaxis of monocytes, thereby participating in the inflammatory response. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7086 Product name: Recombinant human Pericentrin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 307-656 aa of BC000697 Sequence: FLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS Predict reactive species Full Name: nucleoporin 85kDa Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC000697 Gene Symbol: NUP85 Gene ID (NCBI): 79902 RRID: AB_3670955 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BW27 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.