Iright
BRAND / VENDOR: Proteintech

Proteintech, 83291-3-RR, HO-1/Hmox1 Recombinant monoclonal antibody

CATALOG NUMBER: 83291-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HO-1/Hmox1 (83291-3-RR) by Proteintech is a Recombinant antibody targeting HO-1/Hmox1 in WB, IHC, FC (Intra), ELISA applications with reactivity to mouse, rat samples 83291-3-RR targets HO-1/Hmox1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cells, NR8383 cells, NIH/3T3 cells, RAW 264.7 cells, 4T1 cells, mouse liver tissue, mouse kidney tissue, mouse spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0938 Product name: Recombinant mouse HO-1/Hmox1 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 1-266 aa of NM_010442.2 Sequence: MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT Predict reactive species Full Name: heme oxygenase (decycling) 1 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: NM_010442.2 Gene Symbol: HO-1 Gene ID (NCBI): 15368 RRID: AB_3670958 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P14901 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924