Iright
BRAND / VENDOR: Proteintech

Proteintech, 83309-1-RR, BCDIN3D Recombinant monoclonal antibody

CATALOG NUMBER: 83309-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The BCDIN3D (83309-1-RR) by Proteintech is a Recombinant antibody targeting BCDIN3D in WB, ELISA applications with reactivity to human samples 83309-1-RR targets BCDIN3D in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information BCDIN3D (BCDIN3 domain containing RNA methyltransferase), it is expected to be located in cytoplasm, which is ubiquitous expressed in prostate, lymph node and skeletal muscle. This gene encodes an RNA methyltransferase which belongs to the rossmann fold methyltransferase family and serves as a 5'-methylphosphate capping enzyme that is specific for cytoplasmic histidyl tRNA. The encoded protein contains an S-adenosylmethionine binding domain and uses the methyl group donor, S-adenosylmethionine. This gene is overexpressed in breast cancer cells, and is related to the tumorigenic phenotype and poor prognosis of breast cancer. The encoded protein is thought to promote the cellular invasion of breast cancer cells, by downregulating the expression of tumor suppressor miRNAs through the dimethylation of the 5-monophosphate of the corresponding precursor miRNAs. The molecular weight of BCDIN3D is 33 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15613 Product name: Recombinant human BCDIN3D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC053560 Sequence: MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ Predict reactive species Full Name: BCDIN3 domain containing Calculated Molecular Weight: 292 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC053560 Gene Symbol: BCDIN3D Gene ID (NCBI): 144233 RRID: AB_3670975 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7Z5W3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924