Proteintech, 83346-6-RR, SLC38A7 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC38A7 (83346-6-RR) by Proteintech is a Recombinant antibody targeting SLC38A7 in WB, FC (Intra), ELISA applications with reactivity to human samples 83346-6-RR targets SLC38A7 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells, human liver tissue Positive FC (Intra) detected in: Caco-2 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SLC38A7 also known as SNAT7, is a member of the SLC38 family that encodes sodium-coupled neutral amino acid transporters. SLC38A7 is a system N transporter that has a substrate preference for L-glutamine. It also transports other amino acids with polar side chains, as well as L-histidine and L-alanine (PMID: 21511949). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35081 Product name: Recombinant human SLC38A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC001961 Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST Predict reactive species Full Name: solute carrier family 38, member 7 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC001961 Gene Symbol: SLC38A7 Gene ID (NCBI): 55238 RRID: AB_3671005 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NVC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.