Proteintech, 83350-4-RR, CACHD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CACHD1 (83350-4-RR) by Proteintech is a Recombinant antibody targeting CACHD1 in WB, ELISA applications with reactivity to human, mouse samples 83350-4-RR targets CACHD1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CACHD1 (Cache domain-containing protein 1), also called VWCD1 (VWFA and cache domain-containing protein 1), is a type I membrane protein involved that modulates the activities of voltage-gated Ca(2+) channels (VGCCs) (PMID: 30181139; 30404013). CACHD1 has two isoforms, with molecular weights of 142 kDa and 109 kDa respectively. It has certain glycosylation modifications, and the molecular weight of isoform1 after glycosylation modification is 170 kDa (PMID: 30983497; 30404013). This antibody recognizes 142-170 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22138 Product name: Recombinant human CACHD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-348 aa of BC039301 Sequence: MSTFVSSVKSSDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDMVIIYLSAGITSKDSSEEDKKATLQVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRETGKEAYNVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHF Predict reactive species Full Name: cache domain containing 1 Calculated Molecular Weight: 1274 aa, 142 kDa Observed Molecular Weight: 140-170 kDa GenBank Accession Number: BC039301 Gene Symbol: CACHD1 Gene ID (NCBI): 57685 RRID: AB_3671008 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q5VU97 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.