Iright
BRAND / VENDOR: Proteintech

Proteintech, 83361-2-RR, KIAA1217 Recombinant monoclonal antibody

CATALOG NUMBER: 83361-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The KIAA1217 (83361-2-RR) by Proteintech is a Recombinant antibody targeting KIAA1217 in WB, FC (Intra), ELISA applications with reactivity to human samples 83361-2-RR targets KIAA1217 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information KIAA1217, sickle tail protein homolog, is required for normal development of intervertebral disks. It promotes epithelial-mesenchymal transition and hepatocellular carcinoma metastasis by interacting with and activating STAT3, indicating its potential as a therapeutic target for curbing HCC metastasis (PMID: 35008530). It is also a novel candidate gene associated with isolated and syndromic vertebral malformations (PMID: 32369272). KIAA1217 has 9 alternatively spliced isoforms of 100-110 kDa, 140-160 kDa, 210 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19367 Product name: Recombinant human KIAA1217 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 534-852 aa of BC018764 Sequence: PAQNLPHVASSPAVPQEATSTLQMSQAPQSPQIPMNGSAMQSLFIEEIHSVSAKNRAVSIEKAEKKWEEKRQNLDHYNGKEFEKLLEEAQANIMKSIPNLEMPPATGPLPRGDAPVDKVELSEDSPNSEQDLEKLGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRKENITAKASSEDAGPSPQTRATKYPAEEPASAWTPSPPPVTTSSSKDEEEEEEEGDKIMAELQAFQKCSFMDVNSNSHAEPSRADSHVKDTRSGATVPPKEKKNLEFFHEDVRKSDVEYENGPQMEFQKGSSGAPQTSRMPVPMSAKNR Predict reactive species Full Name: KIAA1217 Calculated Molecular Weight: 1943 aa, 214 kDa Observed Molecular Weight: 100-110 kDa, 140-160 kDa, 210 kDa GenBank Accession Number: BC018764 Gene Symbol: KIAA1217 Gene ID (NCBI): 56243 RRID: AB_3671015 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5T5P2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924