Proteintech, 83391-6-RR, NOL11 Recombinant monoclonal antibody

Size: 20ul / 100ul The NOL11 (83391-6-RR) by Proteintech is a Recombinant antibody targeting NOL11 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83391-6-RR targets NOL11 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HT-29 cells, SW480 cells, A431 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NOL11, also named as L14, is a ribosome biogenesis factor. It is required for both optimal rDNA transcription and small subunit (SSU) pre-rRNA processing at sites A', A0, 1 and 2b. NOL11 forms a protein complex with two tryptophan-aspartic acid (WD) repeat proteins named WD-repeat protein 43 (WDR43) and Cirhin in mitotic cells. NOL11 plays a role in pathogenesis of NAIC. There're some isoforms with MW 81 kDa and 19 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11783 Product name: Recombinant human NOL11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC064404 Sequence: MAALEEEFTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNLDKVFKATLSAEVYRILSVQGTEPLVLFKEGAVRGLEALLADPQQKIETVISDEEVIKWTKFFVVFRHPVLIFITEKHGNYFAYVQMFNSRILTKYTLLLGQDENSVIKSFTASVDRKFISLMSLSSDGCIYETLIPIRPADPEKNQSLVKSLLLKAVVSGNARNGVALTALDQDHVAVLGSPLAASKECLSVWNIKFQTLQTSKELPQGTSGQLWYYGEHLFMLHGKSLTVIPYKCEVSSLAGALGKLKHSQDP Predict reactive species Full Name: nucleolar protein 11 Calculated Molecular Weight: 719 aa, 81 kDa Observed Molecular Weight: 81 kDa GenBank Accession Number: BC064404 Gene Symbol: NOL11 Gene ID (NCBI): 25926 RRID: AB_3671045 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9H8H0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.