Iright
BRAND / VENDOR: Proteintech

Proteintech, 83397-5-RR, MPHOSPH9 Recombinant monoclonal antibody

CATALOG NUMBER: 83397-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MPHOSPH9 (83397-5-RR) by Proteintech is a Recombinant antibody targeting MPHOSPH9 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83397-5-RR targets MPHOSPH9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat brain tissue, NIH/3T3 cells, PC-12 cells, SH-SY5Y cells, mouse brain tissue Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MPHOSPH9, also known as MPP9, is a protein phosphorylated during mitosis. MPHOSPH9 negatively regulates cilia formation by recruiting the CP110-CEP97 complex at the distal end of the mother centriole in ciliary cells. MPHOSPH9 is a centrosome component that localizes to the distal and proximal ends of two centrioles(PMID: 30375385). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22228 Product name: Recombinant human MPHOSPH9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-350 aa of BC130440 Sequence: SLSSERNESVIHYPESTEPEIQQEMSTSQPDCNVDSCSVSSGYGTFCISELNLYKSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQKLKQNQPKRAHVEDGGSRSKQGNEQSKKTPIEKSDFAAATHPRAFYLSKPDETPNAWMSDSGTGLTYWKLEEKDMHHSLPETLEKTFISLSSTDVSPNQSNTSNEMKLPSLKDIYYKKQRENKQLPERNLTSASNPNHPPEVLTLDPTLHMKPKQQISGIQPHGLPNALDDRISFSPDSVLEPSMSSPSDIDSFSQASNVTSQ Predict reactive species Full Name: M-phase phosphoprotein 9 Calculated Molecular Weight: 1031 aa, 116 kDa Observed Molecular Weight: 116 kDa GenBank Accession Number: BC130440 Gene Symbol: MPHOSPH9 Gene ID (NCBI): 10198 RRID: AB_3671049 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q99550 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924