Proteintech, 83403-1-RR, SREBF2 Recombinant monoclonal antibody

Size: 20ul / 100ul The SREBF2 (83403-1-RR) by Proteintech is a Recombinant antibody targeting SREBF2 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83403-1-RR targets SREBF2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is required for lipid homeostasis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28205 Product name: Recombinant human SREBF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 375-479 aa of BC056158 Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR Predict reactive species Full Name: sterol regulatory element binding transcription factor 2 Calculated Molecular Weight: 124 kDa GenBank Accession Number: BC056158 Gene Symbol: SREBF2 Gene ID (NCBI): 6721 RRID: AB_3671053 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q12772 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.