Product Description
Size: 20ul / 100ul
The TBX20 (83414-5-RR) by Proteintech is a Recombinant antibody targeting TBX20 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples
83414-5-RR targets TBX20 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: H9C2 cells, mouse heart tissue, rat heart tisue
Positive FC (Intra) detected in: k562
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
Tbx20 is a transcription factor that is essential for proper heart development in a growing fetus. Any mutations in this gene can result in various forms of congenital heart disease.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag18501 Product name: Recombinant human TBX20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-119 aa of BC120946 Sequence: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTE Predict reactive species
Full Name: T-box 20
Calculated Molecular Weight: 297 aa, 33 kDa
Observed Molecular Weight: 50-60 kDa
GenBank Accession Number: BC120946
Gene Symbol: TBX20
Gene ID (NCBI): 57057
RRID: AB_3671063
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: Q9UMR3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924