Product Description
Size: 20ul / 100ul
The PLK2 (83431-1-RR) by Proteintech is a Recombinant antibody targeting PLK2 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples
83431-1-RR targets PLK2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IF/ICC detected in: hTERT-RPE1 cells
Positive FC (Intra) detected in: A549 cells
Recommended dilution
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
PLK2(Polo-like kinase 2) is also named as SNK and belongs to the Ser/Thr protein kinase family. It plays a role in normal cell division. Plk2 expression is detected only in G1, and endogenous Plk2 is rapidly turned over. Therefore, the expression of the three mammalian Plks during the cell cycle resembles the successive transition of the cyclins, prompting speculation that Plks may reg-ulate the cell cycle in a manner analogous to that of Cdks(PMID:12972611).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag29837 Product name: Recombinant human PLK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 357-497 aa of BC013879 Sequence: SSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQL Predict reactive species
Full Name: polo-like kinase 2 (Drosophila)
Calculated Molecular Weight: 685 aa, 78 kDa
GenBank Accession Number: BC013879
Gene Symbol: PLK2
Gene ID (NCBI): 10769
RRID: AB_3671076
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: Q9NYY3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924