Iright
BRAND / VENDOR: Proteintech

Proteintech, 83438-6-RR, TREM2 Recombinant monoclonal antibody

CATALOG NUMBER: 83438-6-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TREM2 (83438-6-RR) by Proteintech is a Recombinant antibody targeting TREM2 in WB, ELISA applications with reactivity to human samples 83438-6-RR targets TREM2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PMA treated THP-1 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information TREM2 (triggering receptor expressed on myeloid cells 2) is a cell surface receptor belongs to TREM family that is expressed on osteoclast, dendritic cells, macrophages, nature killers, neutrophils and microglia (PMID: 19302484). TREM2 is localized predominantly in the Golgi complex, but also shuttles to and from the cell surface in endocytic and exocytic vesicles (PMID: 16675145). TREM2 associates with DAP12 to initiate the intracellular signalling cascade via an immunoreceptor tyrosine-based activation motif (ITAM) domain and tyrosine-kinases (PMID: 23977213). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0747 Product name: Recombinant human TREM2 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 19-174 aa of BC032362 Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRPSQGSHLPSCLSK Predict reactive species Full Name: triggering receptor expressed on myeloid cells 2 Calculated Molecular Weight: 222 aa, 25 kDa Observed Molecular Weight: 26-32 kDa GenBank Accession Number: BC032362 Gene Symbol: TREM2 Gene ID (NCBI): 54209 RRID: AB_3671079 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NZC2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924