Proteintech, 83439-1-RR, POLR2H Recombinant monoclonal antibody

Size: 20ul / 100ul The POLR2H (83439-1-RR) by Proteintech is a Recombinant antibody targeting POLR2H in WB, ELISA applications with reactivity to Human, mouse samples 83439-1-RR targets POLR2H in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HL-60 cells, HepG2 cells, NIH/3T3 cells, Jurkat cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information POLR2H, also known as hRPB8, is a 150 amino acid protein, which localizes in nucleolus and is expressed in 228 organ(s), highest expression level in mucosa of transverse colon. POLR2H. POLR2H is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR2H is a common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7166 Product name: Recombinant human POLR2H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC000739 Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF Predict reactive species Full Name: polymerase (RNA) II (DNA directed) polypeptide H Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC000739 Gene Symbol: POLR2H Gene ID (NCBI): 5437 RRID: AB_3671080 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P52434 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.