Product Description
Size: 20ul / 100ul
The TMEM126A (83440-2-RR) by Proteintech is a Recombinant antibody targeting TMEM126A in WB, IF/ICC, ELISA applications with reactivity to human samples
83440-2-RR targets TMEM126A in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: T-47D cells, HeLa cells, MCF-7 cells, U-251 cells, U2OS cells, human placenta tissue
Positive IF/ICC detected in: HeLa cells
Positive FC (Intra) detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
TMEM126A is a mitochondrial inner membrane protein that is enriched in the cristae. TMEM126A is necessary for Complex I assembly or stability.Complex I (CI) is the largest enzyme of the mitochondrial respiratory chain, and its defects are the main cause of mitochondrial disease.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag14705 Product name: Recombinant human TMEM126A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-195 aa of BC007875 Sequence: AGLPMAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVFLAIPVNGGLAARYQSALLPHKGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKLLIKALQLSEPGKEIH Predict reactive species
Full Name: transmembrane protein 126A
Calculated Molecular Weight: 195 aa, 22 kDa
Observed Molecular Weight: 20-25 kDa
GenBank Accession Number: BC007875
Gene Symbol: TMEM126A
Gene ID (NCBI): 84233
RRID: AB_3671081
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q9H061
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924