Iright
BRAND / VENDOR: Proteintech

Proteintech, 83452-4-RR, GNB3 Recombinant monoclonal antibody

CATALOG NUMBER: 83452-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GNB3 (83452-4-RR) by Proteintech is a Recombinant antibody targeting GNB3 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83452-4-RR targets GNB3 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, L02 cells, HepG2 cells, C6 cells, mouse brain tissue, mouse cerebellum tissue, rat brain tissue Positive FC (Intra) detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Guanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0127 Product name: Recombinant human GNB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-270 aa of BC000115 Sequence: MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESII Predict reactive species Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 3 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 35-37 kDa GenBank Accession Number: BC000115 Gene Symbol: GNB3 Gene ID (NCBI): 2784 RRID: AB_3671089 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P16520 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924