Proteintech, 83462-1-RR, RNF133 Recombinant monoclonal antibody

Size: 20ul / 100ul The RNF133 (83462-1-RR) by Proteintech is a Recombinant antibody targeting RNF133 in WB, ELISA applications with reactivity to Human samples 83462-1-RR targets RNF133 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RNF133 (ring finger protein 133) contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14537 Product name: Recombinant human RNF133 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 208-376 aa of BC022038 Sequence: YHIHRLCLARIQNRRWQRLTTDLQNTFGQLQLRVVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDILKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQNNDIQPHSVVEDVHPSP Predict reactive species Full Name: ring finger protein 133 Calculated Molecular Weight: 376 aa, 42 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC022038 Gene Symbol: RNF133 Gene ID (NCBI): 168433 RRID: AB_3671093 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WVZ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.