Iright
BRAND / VENDOR: Proteintech

Proteintech, 83469-4-RR, GSTT2B Recombinant monoclonal antibody

CATALOG NUMBER: 83469-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GSTT2B (83469-4-RR) by Proteintech is a Recombinant antibody targeting GSTT2B in WB, ELISA applications with reactivity to human, mouse, rat samples 83469-4-RR targets GSTT2B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse liver tissue, mouse lung tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11828 Product name: Recombinant human GSTT2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC071700 Sequence: MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP Predict reactive species Full Name: glutathione S-transferase theta 2B (gene/pseudogene) Calculated Molecular Weight: 244 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC071700 Gene Symbol: GSTT2B Gene ID (NCBI): 653689 RRID: AB_3671099 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P0CG30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924