Proteintech, 83471-5-RR, IKZF4 Recombinant monoclonal antibody

Size: 20ul / 100ul The IKZF4 (83471-5-RR) by Proteintech is a Recombinant antibody targeting IKZF4 in WB, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human samples 83471-5-RR targets IKZF4 in WB, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, K-562 cells, HepG2 cells Positive IF-P detected in: mouse stomach tissue Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IKZF4 is a member of the Ikaros family transcription factors. The Ikaros family was originally designated to function in hematopoiesis, but it is only recently that studies have begun to show the relevance of this family in T helper cell differentiation. IKZF3 was preferentially expressed in TH17 cells and governs TH17 differentiation by silencing IL-2 expression. By investigating the dynamics of the TH17 regulatory network, IKZF4 was proposed by Yosef et al. as a composite in the negative regulatory module for TH17. (PMID: 24644282) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34767 Product name: Recombinant human IKZF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-457 aa of BC160169 Sequence: ERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDST Predict reactive species Full Name: IKAROS family zinc finger 4 (Eos) Observed Molecular Weight: 60 kDa GenBank Accession Number: BC160169 Gene Symbol: IKZF4 Gene ID (NCBI): 64375 RRID: AB_3671101 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9H2S9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.