Proteintech, 83490-2-RR, NELF Recombinant monoclonal antibody

Size: 20ul / 100ul The NELF (83490-2-RR) by Proteintech is a Recombinant antibody targeting NELF in WB, ELISA applications with reactivity to Human samples 83490-2-RR targets NELF in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: COLO 320 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NSMF, also named as NELF (Nasal embryonic LHRH factor), couples NMDA-sensitive glutamate receptor signaling to the nucleus and triggers long-lasting changes in the cytoarchitecture of dendrites and spine synapse processes. NELF plays a major role in promoter-proximal pausing, a widespread phenomenon during early transcription elongation. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34902 Product name: Recombinant human NELF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-268 aa of BC016862 Sequence: KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL Predict reactive species Full Name: nasal embryonic LHRH factor Calculated Molecular Weight: 507 aa, 56 kDa Observed Molecular Weight: 54-60 kDa GenBank Accession Number: BC016862 Gene Symbol: NELF Gene ID (NCBI): 26012 RRID: AB_3671117 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6X4W1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.