Proteintech, 83505-1-RR, SLC17A9 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC17A9 (83505-1-RR) by Proteintech is a Recombinant antibody targeting SLC17A9 in WB, IHC, FC (Intra), ELISA applications with reactivity to mouse, rat samples 83505-1-RR targets SLC17A9 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse pancreas tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24970 Product name: Recombinant human SLC17A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC025312 Sequence: MTLTSRRQDSQEARPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEK Predict reactive species Full Name: solute carrier family 17, member 9 Calculated Molecular Weight: 436 aa, 47 kDa Observed Molecular Weight: 50 kD GenBank Accession Number: BC025312 Gene Symbol: SLC17A9 Gene ID (NCBI): 63910 RRID: AB_3671130 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BYT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.