Product Description
Size: 20ul / 100ul
The SLC17A9 (83505-1-RR) by Proteintech is a Recombinant antibody targeting SLC17A9 in WB, IHC, FC (Intra), ELISA applications with reactivity to mouse, rat samples
83505-1-RR targets SLC17A9 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse pancreas tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive FC (Intra) detected in: Caco-2 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:16000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Specification
Tested Reactivity: mouse, rat
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag24970 Product name: Recombinant human SLC17A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC025312 Sequence: MTLTSRRQDSQEARPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEK Predict reactive species
Full Name: solute carrier family 17, member 9
Calculated Molecular Weight: 436 aa, 47 kDa
Observed Molecular Weight: 50 kD
GenBank Accession Number: BC025312
Gene Symbol: SLC17A9
Gene ID (NCBI): 63910
RRID: AB_3671130
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: Q9BYT1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924