Proteintech, 83509-5-RR, FBXO38 Recombinant monoclonal antibody

Size: 20ul / 100ul The FBXO38 (83509-5-RR) by Proteintech is a Recombinant antibody targeting FBXO38 in WB, IF/ICC, ELISA applications with reactivity to human samples 83509-5-RR targets FBXO38 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, Jurkat cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information F-box-containing protein 38 (FBXO38), a member of the F-box family, was initially discovered as a co-activator of the transcription factor Krüppel-like factor 7 (KLF7) (PMID: 14729953). FBXO38 acts as a substrate-binding receptor for multi-subunit ubiquitin ligase SKP1-CUL1-FBXO38 (PMID: 35769260) . FBXO38 is an E3 ligase of PD-1 that mediates Lys48-linked poly-ubiquitination and subsequent proteasome degradation (PMID: 30487606). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35444 Product name: Recombinant human FBXO38 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 490-700 aa of XM_005268513.1 Sequence: SNQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKNGTRRYSEREEKTGESVQSRELSVSGKGKTPLRKRYNSHQMGQSKQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDV Predict reactive species Full Name: F-box protein 38 Calculated Molecular Weight: 134kDa，1188aa Observed Molecular Weight: 125kDa, 140 kDa, 150kDa GenBank Accession Number: XM_005268513.1 Gene Symbol: FBXO38 Gene ID (NCBI): 81545 RRID: AB_3671133 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q6PIJ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.