Iright
BRAND / VENDOR: Proteintech

Proteintech, 83516-6-RR, PD-1/CD279 Recombinant monoclonal antibody

CATALOG NUMBER: 83516-6-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PD-1/CD279 (83516-6-RR) by Proteintech is a Recombinant antibody targeting PD-1/CD279 in WB, IF-P, ELISA applications with reactivity to mouse samples 83516-6-RR targets PD-1/CD279 in WB, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: EL-4 cells, RAW 264.7 cells, mouse thymus tissue Positive IF-P detected in: mouse spleen tissue, mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Programmed cell death 1 (PD-1, also known as CD279) is an immunoinhibitory receptor that belongs to the CD28/CTLA-4 subfamily of the Ig superfamily. It is a 288 amino acid (aa) type I transmembrane protein composed of one Ig superfamily domain, a stalk, a transmembrane domain, and an intracellular domain containing an immunoreceptor tyrosine-based inhibitory motif (ITIM) as well as an immunoreceptor tyrosine-based switch motif (ITSM) (PMID: 18173375). PD-1 is expressed during thymic development and is induced in a variety of hematopoietic cells in the periphery by antigen receptor signaling and cytokines (PMID: 20636820). Engagement of PD-1 by its ligands PD-L1 or PD-L2 transduces a signal that inhibits T-cell proliferation, cytokine production, and cytolytic function (PMID: 19426218). It is critical for the regulation of T cell function during immunity and tolerance. Blockade of PD-1 can overcome immune resistance and also has been shown to have antitumor activity (PMID: 22658127; 23169436). It has been reported that PD-1 is heavily glycosylated and migrates with an apparent molecular mass of 47-55 kDa on SDS-PAGE, which is larger than its predicted mass of 32 kDa (PMID: 8671665; 17640856; 17003438). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0918 Product name: Recombinant Mouse PD-1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-167 aa of NM_008798.2 Sequence: LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ Predict reactive species Full Name: programmed cell death 1 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: NM_008798.2 Gene Symbol: PD-1 Gene ID (NCBI): 18566 RRID: AB_3671141 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q02242 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924