Proteintech, 83523-4-RR, CD86 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD86 (83523-4-RR) by Proteintech is a Recombinant antibody targeting CD86 in WB, IF/ICC, ELISA applications with reactivity to human samples 83523-4-RR targets CD86 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells, Ramos cells Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0966 Product name: Recombinant Human CD86 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-247 aa of NM_175862 Sequence: LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP Predict reactive species Full Name: CD86 molecule Calculated Molecular Weight: 329 aa, 38 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_175862 Gene Symbol: CD86 Gene ID (NCBI): 942 ENSEMBL Gene ID: ENSG00000114013 RRID: AB_3671150 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P42081 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.