Iright
BRAND / VENDOR: Proteintech

Proteintech, 83548-3-RR, GHITM Recombinant monoclonal antibody

CATALOG NUMBER: 83548-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GHITM (83548-3-RR) by Proteintech is a Recombinant antibody targeting GHITM in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 83548-3-RR targets GHITM in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, SH-SY5Y cells, mouse liver tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:600-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GHITM, also known as MICS1, TMBIM5 or DERP2, is a mitochondrial protein that localizes in the inner membrane. GHITM is involved in mitochondrial morphology in specific cristae structures and the apoptotic release of cytochrome c from the mitochondria (PMID: 18417609). The gene of GHITM maps to chromosome 10q23.1, and encodes a 345-amino-acid protein with a calculated molecular mass of 37 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35170 Product name: Recombinant human GHITM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-72 aa of BC010354 Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSME Predict reactive species Full Name: growth hormone inducible transmembrane protein Calculated Molecular Weight: 345 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC010354 Gene Symbol: GHITM Gene ID (NCBI): 27069 RRID: AB_3671167 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H3K2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924