Iright
BRAND / VENDOR: Proteintech

Proteintech, 83550-4-RR, Chemerin Recombinant monoclonal antibody

CATALOG NUMBER: 83550-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Chemerin (83550-4-RR) by Proteintech is a Recombinant antibody targeting Chemerin in WB, FC (Intra), ELISA applications with reactivity to mouse samples 83550-4-RR targets Chemerin in WB, FC (Intra), ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse adipose tissue, mouse brown adipose tissue Positive FC (Intra) detected in: C57BL/6 mouse liver cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Chemerin, also named as TIG2 and RARRES2, is adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). It positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. RARRES2 have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. The MW of Chemerin is 14-19 kDa. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0875 Product name: Recombinant mouse Chemerin protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-156 aa of NM_001347168.1 Sequence: EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS Predict reactive species Full Name: retinoic acid receptor responder (tazarotene induced) 2 Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 14-19 kDa GenBank Accession Number: NM_001347168.1 Gene Symbol: Chemerin Gene ID (NCBI): 71660 RRID: AB_3671168 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9DD06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924