Iright
BRAND / VENDOR: Proteintech

Proteintech, 83576-4-RR, HBQ1 Recombinant monoclonal antibody

CATALOG NUMBER: 83576-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HBQ1 (83576-4-RR) by Proteintech is a Recombinant antibody targeting HBQ1 in WB, IF/ICC, ELISA applications with reactivity to human samples 83576-4-RR targets HBQ1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HBQ1 (Hemoglobin subunit theta-1) is a member of the human alpha-globin gene cluster. HBQ1 mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue (PMID: 3657976). HBQ1 gene was transcribed in an erythroleukemia cell line. HBQ1 has transcriptionally active and may be expressed in early erythroid tissue (PMID: 3422341). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10105 Product name: Recombinant human HBQ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC056686 Sequence: MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR Predict reactive species Full Name: hemoglobin, theta 1 Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 10~16 kDa GenBank Accession Number: BC056686 Gene Symbol: HBQ1 Gene ID (NCBI): 3049 RRID: AB_3671187 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P09105 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924