Iright
BRAND / VENDOR: Proteintech

Proteintech, 83578-2-RR, S100A9 Recombinant monoclonal antibody

CATALOG NUMBER: 83578-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The S100A9 (83578-2-RR) by Proteintech is a Recombinant antibody targeting S100A9 in WB, IF/ICC, ELISA applications with reactivity to human samples 83578-2-RR targets S100A9 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, THP-1 cells, HL-60 cells Positive IF/ICC detected in: A549 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25764 Product name: Recombinant human S100A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC047681 Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species Full Name: S100 calcium binding protein A9 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC047681 Gene Symbol: S100A9 Gene ID (NCBI): 6280 RRID: AB_3671190 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P06702 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924