Proteintech, 83588-3-RR, TCF7L1 Recombinant monoclonal antibody

Size: 20ul / 100ul The TCF7L1 (83588-3-RR) by Proteintech is a Recombinant antibody targeting TCF7L1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 83588-3-RR targets TCF7L1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, HEK-293 cells, NCCIT cells, NIH/3T3 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TCF7L1 is one of TCF/LEF transcription factors that are mediators of the Wnt signaling pathway and are antagonized by the TGF-beta signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It's necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34253 Product name: Recombinant human TCF7L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 238-587 aa of BC058894 Sequence: GAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSRQMGSQPPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH Predict reactive species Full Name: transcription factor 7-like 1 (T-cell specific, HMG-box) Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 63 kDa, 75 kDa GenBank Accession Number: BC058894 Gene Symbol: TCF7L1 Gene ID (NCBI): 83439 RRID: AB_3671202 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9HCS4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.