Proteintech, 83596-4-RR, BARHL2 Recombinant monoclonal antibody

Size: 20ul / 100ul The BARHL2 (83596-4-RR) by Proteintech is a Recombinant antibody targeting BARHL2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 83596-4-RR targets BARHL2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, rat cerebellum tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information BARHL2 also named as BarH like homeobox 2 is 279 amino acid protein, which contains 1 homeobox DNA-binding domain. BARHL2 localizes in nucleus and belongs to BAR homeobox family. BARHL2 as a transcription factor binds optimally to the DNA consensus sequence. Barx2 may differentially control the expression of L1 and other target genes during embryonic development. Barx2 is expressed in several smooth muscle-containing tissues, as well as skeletal muscle, brain, tongue and esophagus. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21156 Product name: Recombinant human BARHL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC126439 Sequence: MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGTAPSSPISVTMEPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQPPPPPPQQLGSAASAPRTSTSS Predict reactive species Full Name: BarH-like homeobox 2 Calculated Molecular Weight: 387 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC126439 Gene Symbol: BARHL2 Gene ID (NCBI): 343472 RRID: AB_3671212 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NY43 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.