Iright
BRAND / VENDOR: Proteintech

Proteintech, 83607-6-RR, POMP Recombinant monoclonal antibody

CATALOG NUMBER: 83607-6-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The POMP (83607-6-RR) by Proteintech is a Recombinant antibody targeting POMP in WB, ELISA applications with reactivity to human, rat samples 83607-6-RR targets POMP in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, rat skin tissue, Jurkat cells, SW480 cells, HL-60 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Proteasome maturation protein(POMP), is an essential factor of mammalian proteasome biogenesis. It facilitates the main steps in 20S core complex formation at the ER to coordinate the assembly process and to provide cells with freshly formed proteasomes at their site of function. A single nucleotide deletion in this gene causes an autosomal recessive skin disorder, keratosis linearis with ichthyosis congenita and sclerosing keratoderma (KLICK) syndrome. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6987 Product name: Recombinant human POMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC003390 Sequence: MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL Predict reactive species Full Name: proteasome maturation protein Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC003390 Gene Symbol: POMP Gene ID (NCBI): 51371 RRID: AB_3671220 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9Y244 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924