Iright
BRAND / VENDOR: Proteintech

Proteintech, 83608-4-RR, ATM Recombinant monoclonal antibody

CATALOG NUMBER: 83608-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ATM (83608-4-RR) by Proteintech is a Recombinant antibody targeting ATM in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83608-4-RR targets ATM in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells, MCF-7 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25920 Product name: Recombinant human ATM protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1059-1361 aa of BC137169 Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG Predict reactive species Full Name: ataxia telangiectasia mutated GenBank Accession Number: BC137169 Gene Symbol: ATM Gene ID (NCBI): 472 RRID: AB_3671221 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13315 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924