Iright
BRAND / VENDOR: Proteintech

Proteintech, 83628-1-RR, UBC12 Recombinant monoclonal antibody

CATALOG NUMBER: 83628-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The UBC12 (83628-1-RR) by Proteintech is a Recombinant antibody targeting UBC12 in WB, FC (Intra), ELISA applications with reactivity to human samples 83628-1-RR targets UBC12 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells, SMMC-7721 cells, A549 cells, HT-1080 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information UBE2M (Ubiquitin-conjugating enzyme E2 M), also called UBC12, accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction between UBE2M and the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation (PMID: 10207026; 15361859). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5984 Product name: Recombinant human UBC12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-183 aa of BC058924 Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK Predict reactive species Full Name: ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast) Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 17-20 kDa GenBank Accession Number: BC058924 Gene Symbol: UBC12 Gene ID (NCBI): 9040 RRID: AB_3671241 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P61081 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924