Proteintech, 83658-2-RR, RNF216 Recombinant monoclonal antibody

Size: 20ul / 100ul The RNF216 (83658-2-RR) by Proteintech is a Recombinant antibody targeting RNF216 in WB, FC (Intra), IP, ELISA applications with reactivity to human samples 83658-2-RR targets RNF216 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SW480 cells, Caco-2 cells Positive IP detected in: SW480 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information RNF216/TRIAD3 is an RBR (RING-between-RING) E3 ligase that encodes for multiple isoforms that include TRIAD3A, TRIAD3B, TRIAD3C and TRIAD3D/E. RNF216 is a broadly expressed RBR E3 ligase, and loss-of-function mutations in RNF216 are linked to the neurode-generative conditions Gordon-Holmes syndrome (GHS) and Huntington-like disorders (PMID: 34998453, 35620441). RNF216 has three different molecular weights, 99 kDa, 106 kDa and 57 kDa, respectively. Western analysis detected the ~130 kDa band as indicated in literature (PMID: 21270397). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0238 Product name: Recombinant human RNF216 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-276 aa of BC000787 Sequence: KRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTS Predict reactive species Full Name: ring finger protein 216 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 57 kDa, 90-99 kDa, 106~130 kDa GenBank Accession Number: BC000787 Gene Symbol: RNF216 Gene ID (NCBI): 54476 RRID: AB_3671266 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NWF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.