Iright
BRAND / VENDOR: Proteintech

Proteintech, 83695-1-RR, PTPN4 Recombinant monoclonal antibody

CATALOG NUMBER: 83695-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PTPN4 (83695-1-RR) by Proteintech is a Recombinant antibody targeting PTPN4 in WB, IHC, ELISA applications with reactivity to human, rat, pig samples 83695-1-RR targets PTPN4 in WB, IHC, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: rat brain tissue, pig brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information PTPN4 is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. This PTP has been shown to interact with glutamate receptor delta 2 and epsilon subunits, and is thought to play a role in signalling downstream of the glutamate receptors through tyrosine dephosphorylation. Specification Tested Reactivity: human, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1585 Product name: Recombinant human PTPN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 604-927 aa of BC010674 Sequence: NAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPLTTSTNK Predict reactive species Full Name: protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) Calculated Molecular Weight: 106 kDa Observed Molecular Weight: 106 kDa GenBank Accession Number: BC010674 Gene Symbol: PTPN4 Gene ID (NCBI): 5775 RRID: AB_3671298 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29074 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924