Iright
BRAND / VENDOR: Proteintech

Proteintech, 83703-2-RR, GALNT2 Recombinant monoclonal antibody

CATALOG NUMBER: 83703-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GALNT2 (83703-2-RR) by Proteintech is a Recombinant antibody targeting GALNT2 in WB, IHC, ELISA applications with reactivity to human samples 83703-2-RR targets GALNT2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MKN-45 cells, A549 cells, U-87 MG cells, HuH-7 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information GALNT2, a GalNAc-transferase involved in O-linked glycosylation, modulates the risk of atherogenic dyslipidemia, a specific hallmark of insulin resistance and acts as a positive modulator of insulin signaling in human liver cells by down-regulating ENPP1. GALNT2 gene encodes GalNAc-T2 as a regulator of high-density lipoprotein cholesterol (HDL-C) metabolism (PMID: 31040393, 27508872). Western blot analysis detected GALNT2 at an apparent molecular mass of 64 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11523 Product name: Recombinant human GALNT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-571 aa of BC041120 Sequence: FLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ Predict reactive species Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2) Calculated Molecular Weight: 571 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC041120 Gene Symbol: GALNT2 Gene ID (NCBI): 2590 RRID: AB_3671305 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q10471 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924