Proteintech, 83717-4-RR, TFF2 Recombinant monoclonal antibody

Size: 20ul / 100ul The TFF2 (83717-4-RR) by Proteintech is a Recombinant antibody targeting TFF2 in WB, FC (Intra), IP, ELISA applications with reactivity to human samples 83717-4-RR targets TFF2 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human urine sample Positive IP detected in: mouse stomach tissue Positive FC (Intra) detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4537 Product name: Recombinant human TFF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Predict reactive species Full Name: trefoil factor 2 Calculated Molecular Weight: 129 aa, 14 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC032820 Gene Symbol: TFF2 Gene ID (NCBI): 7032 RRID: AB_3671319 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q03403 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.