Proteintech, 83736-4-RR, CBR1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CBR1 (83736-4-RR) by Proteintech is a Recombinant antibody targeting CBR1 in WB, IF/ICC, ELISA applications with reactivity to human samples 83736-4-RR targets CBR1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HEK-293T cells, MCF-7 cells, SKOV-3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information CBR1 belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34830 Product name: Recombinant human CBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-276 aa of BC002511 Sequence: MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQ Predict reactive species Full Name: carbonyl reductase 1 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC002511 Gene Symbol: CBR1 Gene ID (NCBI): 873 RRID: AB_3671336 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P16152 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.