Iright
BRAND / VENDOR: Proteintech

Proteintech, 83767-1-RR, TNC/Tenascin-C Recombinant monoclonal antibody

CATALOG NUMBER: 83767-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TNC/Tenascin-C (83767-1-RR) by Proteintech is a Recombinant antibody targeting TNC/Tenascin-C in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 83767-1-RR targets TNC/Tenascin-C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-87 MG cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27122 Product name: Recombinant human TNC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-200 aa of BC151843 Sequence: GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRC Predict reactive species Full Name: tenascin C Calculated Molecular Weight: 2201 aa, 241 kDa Observed Molecular Weight: 220-350 kDa, 190-240 kDa GenBank Accession Number: BC151843 Gene Symbol: Tenascin C Gene ID (NCBI): 3371 RRID: AB_3671361 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P24821 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924