Proteintech, 83771-5-RR, SMUG1 Recombinant monoclonal antibody

Size: 20ul / 100ul The SMUG1 (83771-5-RR) by Proteintech is a Recombinant antibody targeting SMUG1 in WB, FC (Intra), ELISA applications with reactivity to human samples 83771-5-RR targets SMUG1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MOLT-4 cells, K-562 cells, HEK-293 cells, COLO 320 cells, HeLa cells Positive FC (Intra) detected in: U-2 OS Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information UNG(Uracil-DNA glycosylase) removes uracil in DNA resulting from deamination of cytosine or replicative incorporation of dUMP instead of dTMP. Thus, UNG plays a role in suppressing GC-to-AT transition mutations.The UNG gene encodes 2 isoforms that are individually targeted to the mitochondria and the nucleus(PMID:12369930).Defects in UNG are a cause of immunodeficiency with hyper-IgM type 5 (HIGM5). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13934 Product name: Recombinant human SMUG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC000417 Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQS Predict reactive species Full Name: single-strand-selective monofunctional uracil-DNA glycosylase 1 Calculated Molecular Weight: 177 aa, 20 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC000417 Gene Symbol: SMUG1 Gene ID (NCBI): 23583 RRID: AB_3671365 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q53HV7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.