Iright
BRAND / VENDOR: Proteintech

Proteintech, 83780-3-RR, TDG Recombinant monoclonal antibody

CATALOG NUMBER: 83780-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TDG (83780-3-RR) by Proteintech is a Recombinant antibody targeting TDG in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83780-3-RR targets TDG in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TDG belongs to the TDG/mug DNA glycosylase family. TDG corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. RNF4 interacts with and requires the base excision repair enzymes TDG and APE1 for active demethylation (PMID:20696907). TDG is modified by SUMO-1 and SUMO-2/3.The molecular weight of non-modified TDG is 46 kDa and modified TDG is 55-60 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4190 Product name: Recombinant human TDG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-410 aa of BC037557 Sequence: MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA Predict reactive species Full Name: thymine-DNA glycosylase Calculated Molecular Weight: 410 aa, 46 kDa GenBank Accession Number: BC037557 Gene Symbol: TDG Gene ID (NCBI): 6996 RRID: AB_3671373 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13569 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924