Proteintech, 83787-5-RR, SON Recombinant monoclonal antibody

Size: 20ul / 100ul The SON (83787-5-RR) by Proteintech is a Recombinant antibody targeting SON in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83787-5-RR targets SON in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, human testis tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: HeLa cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SON, also called C21orf50 and DBP5, is a nuclear speckle-localized protein that shares homology with pre-mRNA splicing accessory factors (PMID: 10950926). It is an RNA-binding protein that acts as an mRNA splicing cofactor by promoting efficient splicing of transcripts that possess weak splice sites, and specifically promotes splicing of many cell-cycle and DNA-repair transcripts that possess weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG (PMID: 20581448; 21504830). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27620 Product name: Recombinant human SON protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-182 aa of NM_001291411 Sequence: MVSKFREIQQELSSGRNEGQLNGETNTPIEGNQAGDAAASARSLPNEEIVQKIEEVLSGVLDTELRYKPDLKEGSRKSRCVSVQTDPTDEIPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKTKSHDDGNIDLESDSFLKFDSEPSAVALELPTRAFGPSETNES Predict reactive species Full Name: SON DNA binding protein Calculated Molecular Weight: 264 aa Observed Molecular Weight: 250-300 kDa GenBank Accession Number: NM_001291411 Gene Symbol: SON Gene ID (NCBI): 6651 RRID: AB_3671379 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P18583 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.