Iright
BRAND / VENDOR: Proteintech

Proteintech, 83815-2-RR, NRAS Recombinant monoclonal antibody

CATALOG NUMBER: 83815-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NRAS (83815-2-RR) by Proteintech is a Recombinant antibody targeting NRAS in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 83815-2-RR targets NRAS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, MCF-7 cells, Jurkat cells, NIH/3T3 cells, C6 cells Positive IHC detected in: mouse testis tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information NRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML). NRAS is one member of RAS gene family of oncoproteins, which is commonly mutated in melanoma and hematopoietic cancers via mapped on chromosome 1 (PMID: 2327491, PMID: 26990546). NRAS mediates activation of both mitogen-activated protein kinase (MAPK) and PI3K/AKT/MYC signaling (PMID: 17297468). NRAS induced classical MAPK signaling leads to cyclin D1 expression and cell cycle dysregulation and promotion of prosurvival pathways (PMID:7970723,PMID: 18246127). In addition, NRAS effectively prevents Glycogen Synthase Kinase3 (GSK3)-mediated phosphorylation of MYC via PI3K/AKT, which results in enhanced activity of endogenous MYC protein (PMID: 17297468). Mutational NRAS causes Ras-GTP to be in a state of continuous activation, which results in malignant proliferation and metastasis (PMID: 24985059). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1081 Product name: Recombinant human NRAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC005219 Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM Predict reactive species Full Name: neuroblastoma RAS viral (v-ras) oncogene homolog Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC005219 Gene Symbol: NRAS Gene ID (NCBI): 4893 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01111 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924