Proteintech, 83818-1-RR, PSENEN Recombinant monoclonal antibody

Size: 20ul / 100ul The PSENEN (83818-1-RR) by Proteintech is a Recombinant antibody targeting PSENEN in WB, ELISA applications with reactivity to human samples 83818-1-RR targets PSENEN in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information PSENEN, also named PEN2, is a component of the gamma-secretase complex, which also includes presenilin (PSEN1) and nicastrin (NCSTN). The gamma-secretase complex is required for the intramembrane proteolysis of a number of membrane proteins, including the amyloid-beta precursor protein (APP) and Notch. PSENEN is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9243 Product name: Recombinant human PSENEN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC009575 Sequence: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP Predict reactive species Full Name: presenilin enhancer 2 homolog (C. elegans) Calculated Molecular Weight: 101 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC009575 Gene Symbol: PSENEN Gene ID (NCBI): 55851 RRID: AB_3671404 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NZ42 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.