Iright
BRAND / VENDOR: Proteintech

Proteintech, 83822-2-RR, COPS3 Recombinant monoclonal antibody

CATALOG NUMBER: 83822-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The COPS3 (83822-2-RR) by Proteintech is a Recombinant antibody targeting COPS3 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 83822-2-RR targets COPS3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HT-29 cells, HEK-293T cells, mouse ovary tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Positive IF/ICC detected in: A431 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Background Information COPS3 possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32825 Product name: Recombinant human COPS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 270-423 aa of BC001891 Sequence: NNPSELRNLVNKHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS Predict reactive species Full Name: COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis) Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC001891 Gene Symbol: COPS3 Gene ID (NCBI): 8533 RRID: AB_3671406 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UNS2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924