Proteintech, 83841-4-RR, SMAD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The SMAD2 (83841-4-RR) by Proteintech is a Recombinant antibody targeting SMAD2 in WB, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human, rat samples 83841-4-RR targets SMAD2 in WB, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, C6 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: Jurkat cells Positive ChIP-qPCR detected in: TGF-β3 (7 ng/ml, 1h) HaCaT cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information SMAD2, also named as MADH2 and MADR2, belongs to the dwarfin/SMAD family, contains 1 MH1 (MAD homology 1) domain and 1 MH2 (MAD homology 2) domain. SMAD2 is a receptor-regulated SMAD(R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta and activin type 1 receptor kinases. This protein may act as a tumor suppressor in colorectal carcinoma. It is phosphorylated on one or several of Thr-220, Ser-245, Ser-250, and Ser-255. In response to TGF-beta, It is phosphorylated on Ser-465/467 by TGF-beta and activin type 1 receptor kinases, and then able to interact with SMURF2, recruiting other proteins, such as SNON, for degradation. In response to decorin, the naturally occurring inhibitor of TGF-beta signaling, it is phosphorylated on Ser-240 by CaMK2. It is phosphorylated by MAPK3 upon EGF stimulation; which increases transcriptional activity and stability, and is blocked by calmodulin. In response to TGF-beta, it is ubiquitinated by NEDD4L, which promotes its degradation. In response to TGF-beta signaling, it is acetylated on Lys-19 by coactivators, which increases transcriptional activity. The molecular weight of unphosphorylated forms of Smad2 is 52 kDa and phosphorylated forms of Smad2 is 58 kDa. (PMID: 9006934) Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3237 Product name: Recombinant human SMAD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC014840 Sequence: MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAI Predict reactive species Full Name: SMAD family member 2 Calculated Molecular Weight: 467 aa, 52 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC014840 Gene Symbol: SMAD2 Gene ID (NCBI): 4087 RRID: AB_3671425 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q15796 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.