Iright
BRAND / VENDOR: Proteintech

Proteintech, 83844-5-RR, SLC31A1 Recombinant monoclonal antibody

CATALOG NUMBER: 83844-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SLC31A1 (83844-5-RR) by Proteintech is a Recombinant antibody targeting SLC31A1 in WB, ELISA applications with reactivity to human samples 83844-5-RR targets SLC31A1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, SW480 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SLC31A1, also known as CTR1, COPT1 and solute carrier family 31 member 1, is a high-affinity copper transporter found in the cell membrane of human cells. It plays a crucial role in maintaining copper homeostasis within the body and functions as a homotrimer to influence dietary copper absorption in the cell membrane (PMID: 37853210; 28507097). SLC31A1 has three putative transmembrane domains, with an N-terminus located extracellularly and a C-terminus located intracellularly (PMID: 12827356). SLC31A1 can be detected a a 28 kDa band corresponding to glycosylated hCTR1 monomer, and a 24 kDa band that is unglycosylated hCTR1. In some membrane preparations a C-terminal degradation product of 17 kDa is also seen (PMID: 16135512). Additionally, SLC31A1 may also resolve as a 30 to 35 kDa and a 60 to 70 kDa protein on immunoblots, forming oligomers corresponding to the expected size of a homotrimeric complex (PMID: 12827356). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26601 Product name: Recombinant human SLC31A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species Full Name: solute carrier family 31 (copper transporters), member 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21-23 kDa GenBank Accession Number: BC013611 Gene Symbol: SLC31A1 Gene ID (NCBI): 1317 RRID: AB_3671429 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O15431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924