Iright
BRAND / VENDOR: Proteintech

Proteintech, 83854-2-RR, VWF Recombinant monoclonal antibody

CATALOG NUMBER: 83854-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The VWF (83854-2-RR) by Proteintech is a Recombinant antibody targeting VWF in WB, IHC, IF-P, ELISA applications with reactivity to human, rat samples 83854-2-RR targets VWF in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human placenta tissue, rat spleen tissue Positive IHC detected in: human tonsillitis tissue, human ovary cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Background Information Von Willebrand factor (VWF) is a large multimeric glycoprotein found in blood plasma involved in hemostasis following vascular injury. Due to the multimeric nature of VWF, it can range in size from 500 to 20,000 kDa due to the differences in the number of subunits comprising the protein. Each subunit is approximately 250 kDa (PMID: 9759493). The biosynthesis of VWF in vivo is limited to endothelial cells (PMID: 4209883) and megakaryocytes (PMID: 2413071). VWF synthesized in endothelial cells is either released directly into the plasma via 27186a secretory pathway, or tubulized and stored in organelles unique to this cell type called Weibel-Palade bodies (PMID: 16459301). Whereas VWF synthesized in megakaryocytes is stored in the alpha granules of platelets (PMID: 2046403). The primary function of VWF is as an adhesive plasma glycoprotein, particularly factor VIII; an essential blood-clotting protein (PMID: 6982084). VWF is also important in platelet adhesion to wound sites by binding specifically to type I and type III collagen (PMID: 11098050), with larger VWF multimers being most effective (PMID: 24448155). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25578 Product name: Recombinant human vwf protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 754-854 aa of Sequence: MSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCQD Predict reactive species Full Name: von Willebrand factor Observed Molecular Weight: 309-320 kDa Gene Symbol: VWF Gene ID (NCBI): 7450 RRID: AB_3671439 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04275 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924